LC-MS/MS raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-02-27. Anything still debated is marked as such rather than presented as settled.
Cardarine is the common name for GW501516, a synthetic compound studied as a peroxisome proliferator-activated receptor delta agonist. Researchers developed it to explore treatments for lipid disorders and metabolic conditions. It is not an approved medicine in any country. Early clinical work examined changes in HDL cholesterol and triglycerides, but development was discontinued after animal studies raised concerns about cancer. The compound remains available as a research chemical and appears in discussions of performance enhancement.
At the molecular level, GW501516 binds and activates PPARδ, a nuclear receptor that regulates transcription. Activation shifts expression of genes involved in fatty acid oxidation, energy expenditure, and lipid transport in skeletal muscle and liver. Animal studies report increased endurance and altered lipid profiles after exposure. Human data are limited to small trials and do not establish long-term safety or efficacy. PPARδ also has roles in cell proliferation, so the relationship between activation and cancer risk remains an open question.
Published literature on cardarine includes in vitro assays, rodent experiments, and a small number of human studies. Reports describe effects on exercise capacity and lipid metabolism in animals, while human evidence is sparse. Many online descriptions present the compound as a proven endurance aid, a claim not supported by regulatory approval or large clinical trials. Analytical studies focus on identifying the parent compound and its metabolites in biological samples. Important uncertainties include species differences, dose-response relationships, and the relevance of rodent tumor findings to humans.
Analytical laboratories typically identify cardarine and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is a common matrix in anti-doping testing, while blood and tissue may be used in research settings. Detection windows depend on the assay, the sample matrix, and the compound's metabolism. Because cardarine is extensively metabolized, laboratories often target specific metabolites to improve sensitivity and confirmation. Reference standards are required for reliable quantification. Method validation includes checks for selectivity, linearity, and carryover.
A persistent misconception is that cardarine is a fat-burning drug or a safe alternative to anabolic steroids. No approved therapeutic product exists, and human safety data are limited. The tumor findings in rodents remain a central concern in scientific reviews. Products sold online may contain inaccurate labels, impurities, or different compounds entirely, which complicates any assessment of effects. Independent testing of such products has reported frequent mislabeling. For these reasons, discussions in the literature emphasize risks and unknowns rather than benefits.
| Property | Value | Notes |
|---|---|---|
| Common name | Cardarine | Also called GW501516 and endurobol. |
| Chemical formula | C21H18F3NO3S2 | Molecular weight about 453.5 g/mol. |
| Appearance | White to off-white solid | Form depends on synthesis and purity. |
| Solubility | Soluble in DMSO and ethanol | Low solubility in water. |
| Typical storage | -20 °C, desiccated, protected from light | Common for research chemicals. |
Cardarine is explicitly prohibited by the World Anti-Doping Agency under the class of PPARδ agonists. Its presence in urine or blood samples can be detected using mass spectrometry-based methods, often liquid chromatography-tandem mass spectrometry. Athletes who test positive may face sanctions, including bans from competition. The compound is also regulated as a prescription-only or unapproved drug in many countries. Enforcement varies by jurisdiction, and some regions treat it as a controlled substance. Online sales may occur despite these restrictions, creating quality and legal risks.
Laboratory detection of cardarine typically involves sample preparation followed by chromatographic separation and mass spectrometric identification. Urine is the most common matrix for anti-doping tests, though blood and hair have also been explored. Methods can target the parent compound or its metabolites, depending on the expected window of detection. Reference standards are required for accurate quantification. Matrix effects and dilution can influence results, so laboratories use internal standards and validation protocols. The exact detection window varies with dose, route, and individual metabolism.
A common misconception is that cardarine has been proven safe for human use. In reality, human clinical data are limited, and long-term animal studies have raised concerns about cancer. Another misconception is that it is a supplement or vitamin-like compound. It is a synthetic research chemical with no approved medical indication. Scientific discussion often focuses on its mechanism and detection rather than therapeutic use. Regulatory and anti-doping literature treats it primarily as a prohibited substance.
Laboratory detection of GW501516 commonly uses liquid chromatography coupled with tandem mass spectrometry. The method can identify the parent compound or its metabolites in urine and blood after sample cleanup. Protein precipitation, solid-phase extraction, or enzymatic hydrolysis may precede analysis, depending on the matrix. Reference standards are required for accurate quantification and confirmation. Because the compound is not approved, testing often occurs in anti-doping, forensic, or research settings rather than routine clinical care. Results are reported with limits of detection and quantification.
Stability of GW501516 depends on form, temperature, light exposure, and moisture. Solid reference material is typically stored frozen or refrigerated in a desiccator and protected from light. Solutions in organic solvents such as dimethyl sulfoxide are often kept frozen in aliquots to reduce freeze-thaw cycling. Aqueous solubility is low, so aqueous stock solutions can be difficult to prepare without cosolvents. Degradation may appear as changes in chromatographic purity or mass spectral signal. Stability studies are needed to establish shelf life for any specific preparation.
Quality assessment for cardarine samples usually combines identity, purity, and impurity testing. Nuclear magnetic resonance spectroscopy and mass spectrometry can confirm molecular structure, while high-performance liquid chromatography estimates purity. Certificates of analysis from testing laboratories may list these results, but they do not establish safety or legality. In the absence of approved manufacturing, products sold online may contain the wrong compound, variable amounts, or unlisted contaminants. Independent verification is therefore central to analytical work and to interpreting any reported biological activity.
GW501516 acts as an agonist at the peroxisome proliferator-activated receptor delta, a nuclear receptor that regulates gene expression. Activation shifts transcription toward genes involved in fatty acid uptake, oxidation, and energy expenditure. The compound does not bind the androgen receptor and therefore differs from anabolic steroids and SARMs. In rodent models, this metabolic shift has been linked to increased running endurance and reduced fat accumulation. The exact downstream pathways in humans remain incompletely characterized.
Early clinical research explored GW501516 for lipid disorders, obesity, and diabetes. Some short-term human studies reported changes in HDL cholesterol, LDL cholesterol, and triglycerides. The development program was discontinued after rodent studies showed dose-dependent tumor formation in multiple tissues, including liver, bladder, stomach, and skin. These findings raised concerns about long-term cancer risk in humans. Because human exposure data are limited, the clinical significance of the rodent tumors remains uncertain.
=== Domestic use === When a sanitary potable water supply is plumbed to an unsanitary system, for example lawn sprinklers, a dish washer or a washing machine, a check valve called a backflow preventer is used to prevent contaminated water from re-entering the domestic water supply. Some types of irrigation sprinklers and drip irrigation emitters have small check valves built into them to keep the lines from draining when the system is shut off. Check valves used in domestic heating systems to prevent vertical convection, especially in combination with solar thermal installations, also are called gravity brakes. Rainwater harvesting systems that are plumbed into the main water supply of a utility provider may be required to have one or more check valves fitted to prevent contamination of the primary supply by rainwater. Hydraulic jacks use ball check valves to build pressure on the lifting side of the jack. Check valves are commonly used in inflatables, such as toys, mattresses and boats. This allows the object to be inflated without continuous or uninterrupted air pressure.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
After the battle, there were other several clashes between militiamen and gang members. Throughout the 2010s there were several arrests and convictions against militiamen and drug traffickers involved in the massacres. The militias managed to conquer several territories under the control of the Comando Vermelho, although some of them later returned to the gang's control after being reconquered during clashes. In November 2010, another massacre occurred between the military police and the CV, resulting in the deaths of 41 people. On 1 February 2012, during a raid conducted by the Polícia Militar (PM), a "Caveirão" was destroyed by the Comando Vermelho in the favela of Jacarezinho, no injuries were reported. During the course of the massacre, the CV and the militias began recruiting child soldiers. On 19 November 2016, during an operation of the PM, a military police helicopter was shot down by Comando Vermelho in the favela of Cidade de Deus, in the crash four policemen died. On 9 February 2020, a prominent militia faction leader, Adriano Magalhães da Nóbrega, also known as "Capitão Adriano" or "Gordinho", was seriously injured in a police operation and later died in a hospital. On 15 October, in one of the deadliest operations against militias, the PM clash with a convoy of the militias killing 12 paramilitaries on Itaguaí, also a policeman was injured. In the Morro do Fubá favela, the residents were forced to pay a monthly fee of 50 brazilian reals as part of a protection racket.
=== Mass spectrometry === Mass spectrometry provides information about the structure and composition of the complexes. Spectra for metal polycarbonyls are often easily interpretable, because the dominant fragmentation process is the loss of carbonyl ligands (m/z = 28).
Sources: en.wikipedia.org
== History == The first SARMs were arylpropionamides derived from the nonsteroidal antiandrogen bicalutamide. They were discovered by James T. Dalton and colleagues at the University of Tennessee and other institutions and were first described in a paper published in 1998. At the time, these AR agonists were referred to as "nonsteroidal androgens", a drug class that had not been previously described. By 1999 however, on the basis of the selective estrogen receptor modulator (SERM)-like mixed agonist–antagonist and tissue-selective activity of these nonsteroidal AR agonists, the term "selective androgen receptor modulator" or "SARM" was introduced and adoption of this name had begun. The arylpropionamide SARM andarine (GTx-007; S-4) was first described in the literature by 2002. In 2003, arylpropionamide AR agonists, including andarine, were first reported to possess SARM-type tissue selectivity in vivo. Enobosarm (GTx-024; S-22), another arylpropionamide SARM, was first identified in 2004 and was first described in the literature in 2005. GTx, a pharmaceutical company founded in Memphis, Tennessee in 1997, licensed the rights to enobosarm from the University of Tennessee Research Foundation and began developing it as a pharmaceutical drug. A phase 1 clinical trial employing enobosarm had been completed by 2005. By 2007, enobosarm was in a phase 2 trial, and that year GTx signed an exclusive license agreement for its SARM program with Merck & Co. The companies ended the deal in 2010.
=== Realization === The centrifugal partition chromatograph instrument is constituted with a unique rotor which contains the column. This rotor rotates on its central axis (while HSCCC column rotates on its planetary axis and simultaneously rotates eccentrically about another solar axis). With less vibrations and noise, the CPC offers a typical rotation speed range from 500 to 2000 rpm. Contrary to hydrodynamic CCC, the rotation speed is not directly proportional to the retention volume ratio of the stationary phase. Like DCCC, CPC can be operated in either descending or ascending mode, where the direction is relative to the force generated by the rotor rather than gravity. A redesigned CPC column with larger chambers and channels has been named centrifugal partition extraction (CPE). In the CPE design, faster flow rates and increased column loading can be achieved.
=== Classification by culturing === Culture techniques are designed to promote the growth and identify particular bacteria while restricting the growth of the other bacteria in the sample. Often these techniques are designed for specific specimens; for example, a sputum sample will be treated to identify organisms that cause pneumonia, while stool specimens are cultured on selective media to identify organisms that cause diarrhoea while preventing growth of non-pathogenic bacteria. Specimens that are normally sterile, such as blood, urine or spinal fluid, are cultured under conditions designed to grow all possible organisms. Other organisms may need to be identified by their growth in special media, or by other techniques, such as serology.
Sources: en.wikipedia.org
Cardarine is a common name for the investigational compound GW501516. It acts as a PPARδ agonist and is not approved for human use. It is prohibited in sport.
It activates PPARδ, a nuclear receptor that influences gene expression related to lipid and energy metabolism. Animal studies show changes in endurance and lipid levels. Human effects and risks are not well established.
No, cardarine is not a steroid. It belongs to a different chemical class, the PPARδ agonists. It is also not a selective androgen receptor modulator.
No. Cardarine has not received approval for human therapeutic use in major jurisdictions. It remains an investigational compound.